| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
| Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
| Protein HIV-1 capsid protein [47945] (1 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries) |
| Domain d4wyma1: 4wym A:1-147 [262158] Other proteins in same PDB: d4wyma2, d4wymb2, d4wymc2, d4wymd2, d4wyme2, d4wymf2, d4wymg2, d4wymh2, d4wymj2, d4wymk2 automated match to d2m8lb1 |
PDB Entry: 4wym (more details), 2.6 Å
SCOPe Domain Sequences for d4wyma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wyma1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp
Timeline for d4wyma1: