SCOPe 2.08: Domain d4wymf2: 4wym F:148-220

Lineage for d4wymf2 (4wym F:148-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries)

8. Domain d4wymf2: 4wym F:148-220 [262157]
   Other proteins in same PDB: d4wyma1, d4wymb1, d4wymc1, d4wymd1, d4wyme1, d4wymf1, d4wymg1, d4wymh1, d4wymi1, d4wymj1, d4wymk1, d4wyml1
   automated match to d2m8pa2

Details for d4wymf2

PDB Entry: 4wym, 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6

PDB Compounds: (F:) capsid protein p24

SCOPe Domain Sequences for d4wymf2:

Sequence; same for both SEQRES and ATOM records:

>d4wymf2 a.28.3.0 (F:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqg

Timeline for d4wymf2:

• d4wymf2 first appeared in SCOPe 2.04
  
• d4wymf2 appears in SCOPe 2.07