Lineage for d4wyme2 (4wym E:148-220)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731303Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1731376Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1731377Protein automated matches [191156] (8 species)
    not a true protein
  7. 1731415Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (3 PDB entries)
  8. 1731422Domain d4wyme2: 4wym E:148-220 [262156]
    Other proteins in same PDB: d4wyma1, d4wymb1, d4wymc1, d4wymd1, d4wyme1, d4wymf1, d4wymg1, d4wymh1, d4wymi1, d4wymj1, d4wymk1, d4wyml1
    automated match to d2m8pa2

Details for d4wyme2

PDB Entry: 4wym (more details), 2.6 Å

PDB Description: structural basis of hiv-1 capsid recognition by cpsf6
PDB Compounds: (E:) capsid protein p24

SCOPe Domain Sequences for d4wyme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wyme2 a.28.3.0 (E:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqg

SCOPe Domain Coordinates for d4wyme2:

Click to download the PDB-style file with coordinates for d4wyme2.
(The format of our PDB-style files is described here.)

Timeline for d4wyme2: