| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (8 species) not a true protein |
| Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (3 PDB entries) |
| Domain d4wyme2: 4wym E:148-220 [262156] Other proteins in same PDB: d4wyma1, d4wymb1, d4wymc1, d4wymd1, d4wyme1, d4wymf1, d4wymg1, d4wymh1, d4wymi1, d4wymj1, d4wymk1, d4wyml1 automated match to d2m8pa2 |
PDB Entry: 4wym (more details), 2.6 Å
SCOPe Domain Sequences for d4wyme2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wyme2 a.28.3.0 (E:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqg
Timeline for d4wyme2: