Class a: All alpha proteins [46456] (290 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein HIV-1 capsid protein [47945] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
Domain d4wymf1: 4wym F:1-147 [262154] Other proteins in same PDB: d4wyma2, d4wymb2, d4wymc2, d4wymd2, d4wyme2, d4wymf2, d4wymg2, d4wymh2, d4wymj2, d4wymk2 automated match to d2m8lb1 |
PDB Entry: 4wym (more details), 2.6 Å
SCOPe Domain Sequences for d4wymf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wymf1 a.73.1.1 (F:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
Timeline for d4wymf1: