Lineage for d4wwna3 (4wwn A:525-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725640Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2725641Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2725642Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)
  8. 2725701Domain d4wwna3: 4wwn A:525-725 [262149]
    Other proteins in same PDB: d4wwna1, d4wwna2, d4wwna4
    automated match to d1e7ua1
    complexed with 3vc, so4

Details for d4wwna3

PDB Entry: 4wwn (more details), 2.7 Å

PDB Description: crystal structure of human pi3k-gamma in complex with (s)-n-(1-(7- fluoro-2-(pyridin-2-yl)quinolin-3-yl)ethyl)-9h-purin-6-amine amg319 inhibitor
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4wwna3:

Sequence, based on SEQRES records: (download)

>d4wwna3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d4wwna3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssv
kwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddv
lhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavi
leaylrgcg

SCOPe Domain Coordinates for d4wwna3:

Click to download the PDB-style file with coordinates for d4wwna3.
(The format of our PDB-style files is described here.)

Timeline for d4wwna3: