Lineage for d4wo4c2 (4wo4 C:126-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751006Domain d4wo4c2: 4wo4 C:126-214 [262142]
    Other proteins in same PDB: d4wo4a1, d4wo4a2, d4wo4a3, d4wo4b_, d4wo4c1, d4wo4d1
    automated match to d2f54d2
    complexed with jls

Details for d4wo4c2

PDB Entry: 4wo4 (more details), 2.5 Å

PDB Description: the molecular bases of delta/alpha beta t cell-mediated antigen recognition.
PDB Compounds: (C:) TCR variable DELTA 1 CHAIN and TCR constant Alpha

SCOPe Domain Sequences for d4wo4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wo4c2 b.1.1.2 (C:126-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4wo4c2:

Click to download the PDB-style file with coordinates for d4wo4c2.
(The format of our PDB-style files is described here.)

Timeline for d4wo4c2: