SCOPe 2.06: Domain d4wumd2: 4wum D:236-389

Lineage for d4wumd2 (4wum D:236-389)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Freesia hybrid [TaxId:867926] [261023] (1 PDB entry)

8. Domain d4wumd2: 4wum D:236-389 [262139]
   Other proteins in same PDB: d4wuma1, d4wumb1, d4wumc1, d4wumd1
   automated match to d1bi5a2

Details for d4wumd2

PDB Entry: 4wum, 1.77 Å

PDB Description: x-ray crystal structure of chalcone synthase from freesia hybrida

PDB Compounds: (D:) chalcone synthase

SCOPe Domain Sequences for d4wumd2:

Sequence; same for both SEQRES and ATOM records:

>d4wumd2 c.95.1.0 (D:236-389) automated matches {Freesia hybrid [TaxId: 867926]}
ifemvsaaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdy
nslfwiahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksae
ekngttgeglewgvlfgfgpgltvetvvlhsvea

Timeline for d4wumd2:

• d4wumd2 first appeared in SCOPe 2.04
  
• d4wumd2 appears in SCOPe 2.05
  
• d4wumd2 appears in SCOPe 2.07
  
• d4wumd2 appears in the current release, SCOPe 2.08