| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein automated matches [226868] (6 species) not a true protein |
| Species Freesia hybrid [TaxId:867926] [261021] (1 PDB entry) |
| Domain d4wumb1: 4wum B:1-235 [262135] Other proteins in same PDB: d4wuma2, d4wumb2, d4wumc2, d4wumd2 automated match to d1cmla1 |
PDB Entry: 4wum (more details), 1.77 Å
SCOPe Domain Sequences for d4wumb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wumb1 c.95.1.2 (B:1-235) automated matches {Freesia hybrid [TaxId: 867926]}
mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc
eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp
kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen
nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierp
Timeline for d4wumb1: