![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (60 species) not a true protein |
![]() | Species Freesia hybrid [TaxId:867926] [261023] (1 PDB entry) |
![]() | Domain d4wuma2: 4wum A:236-389 [262133] Other proteins in same PDB: d4wuma1, d4wumb1, d4wumc1, d4wumd1 automated match to d1bi5a2 |
PDB Entry: 4wum (more details), 1.77 Å
SCOPe Domain Sequences for d4wuma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wuma2 c.95.1.0 (A:236-389) automated matches {Freesia hybrid [TaxId: 867926]} ifemvsaaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdy nslfwiahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksae ekngttgeglewgvlfgfgpgltvetvvlhsvea
Timeline for d4wuma2: