Lineage for d4wuma2 (4wum A:236-389)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917720Species Freesia hybrid [TaxId:867926] [261023] (1 PDB entry)
  8. 2917721Domain d4wuma2: 4wum A:236-389 [262133]
    Other proteins in same PDB: d4wuma1, d4wumb1, d4wumc1, d4wumd1
    automated match to d1bi5a2

Details for d4wuma2

PDB Entry: 4wum (more details), 1.77 Å

PDB Description: x-ray crystal structure of chalcone synthase from freesia hybrida
PDB Compounds: (A:) chalcone synthase

SCOPe Domain Sequences for d4wuma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuma2 c.95.1.0 (A:236-389) automated matches {Freesia hybrid [TaxId: 867926]}
ifemvsaaqtilpdsegaidghlrevgltfhllkdvpgiisknieksleeafkplgitdy
nslfwiahpggpaildqveakiglkpeklratrhvlseygnmssacvlfileemrkksae
ekngttgeglewgvlfgfgpgltvetvvlhsvea

SCOPe Domain Coordinates for d4wuma2:

Click to download the PDB-style file with coordinates for d4wuma2.
(The format of our PDB-style files is described here.)

Timeline for d4wuma2: