Lineage for d1uvt.1 (1uvt L:,H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Thrombin [50531] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
    Uniprot P00734 333-622
  8. Domain d1uvt.1: 1uvt L:,H: [26213]
    complexed with i48

Details for d1uvt.1

PDB Entry: 1uvt (more details), 2.5 Å

PDB Description: bovine thrombin--bm14.1248 complex
PDB Compounds: (H:) thrombin, (L:) thrombin

SCOPe Domain Sequences for d1uvt.1:

Sequence, based on SEQRES records: (download)

>g1uvt.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
cglrplfekkqvqdqtekelfesyiXivegqdaevglspwqvmlfrkspqellcgaslis
drwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihprynwke
nldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwttsvae
vqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvmksp
ynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid

Sequence, based on observed residues (ATOM records): (download)

>g1uvt.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
cglrplfekkqvqdqtekelfesyiXivegqdaevglspwqvmlfrkspqellcgaslis
drwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihprynwke
nldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretvqpsvlq
vvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyq
mgivswgegcdrdgkygfythvfrlkkwikvid

SCOPe Domain Coordinates for d1uvt.1 are not available.

Timeline for d1uvt.1: