SCOPe 2.05: Domain d3wo3g_: 3wo3 G:

Lineage for d3wo3g_ (3wo3 G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)

6. Protein Interleukin-18 [101782] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101783] (4 PDB entries)

8. Domain d3wo3g_: 3wo3 G: [262125]
   automated match to d1j0sa_
   complexed with nag, so4

Details for d3wo3g_

PDB Entry: 3wo3, 3.1 Å

PDB Description: crystal structure of il-18 in complex with il-18 receptor alpha

PDB Compounds: (G:) Interleukin-18

SCOPe Domain Sequences for d3wo3g_:

Sequence; same for both SEQRES and ATOM records:

>d3wo3g_ b.42.1.2 (G:) Interleukin-18 {Human (Homo sapiens) [TaxId: 9606]}
yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm
avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy
egyflacekerdlfklilkkedelgdrsimftvqne

Timeline for d3wo3g_:

• d3wo3g_ first appeared in SCOPe 2.04
  
• d3wo3g_ appears in SCOPe 2.06
  
• d3wo3g_ appears in the current release, SCOPe 2.08