Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein Interleukin-18 [101782] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101783] (4 PDB entries) |
Domain d3wo3c_: 3wo3 C: [262121] automated match to d1j0sa_ complexed with nag, so4 |
PDB Entry: 3wo3 (more details), 3.1 Å
SCOPe Domain Sequences for d3wo3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wo3c_ b.42.1.2 (C:) Interleukin-18 {Human (Homo sapiens) [TaxId: 9606]} yfgklesklsvirnlndqvlfidqgnrplfedmtdsdcrdnaprtifiismykdsqprgm avtisvkcekistlscenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy egyflacekerdlfklilkkedelgdrsimftvqne
Timeline for d3wo3c_: