Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Thrombin [50531] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries) |
Domain d1mkw.1: 1mkw L:,H: [26211] |
PDB Entry: 1mkw (more details), 2.3 Å
SCOP Domain Sequences for d1mkw.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1mkw.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} eadcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcga slisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpry nwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtt svaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfv mkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid
Timeline for d1mkw.1: