Lineage for d1mkw.1 (1mkw L:,H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670861Protein Thrombin [50531] (2 species)
  7. 670862Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
  8. 670885Domain d1mkw.1: 1mkw L:,H: [26211]

Details for d1mkw.1

PDB Entry: 1mkw (more details), 2.3 Å

PDB Description: the co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement of the yppw segment and active site residues upon ligand binding
PDB Compounds: (H:) alpha-thrombin, (L:) alpha-thrombin

SCOP Domain Sequences for d1mkw.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1mkw.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
eadcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpry
nwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtt
svaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfv
mkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid

SCOP Domain Coordinates for d1mkw.1:

Click to download the PDB-style file with coordinates for d1mkw.1.
(The format of our PDB-style files is described here.)

Timeline for d1mkw.1: