Lineage for d4wkgc2 (4wkg C:201-304)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404074Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2404075Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2404076Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 2404092Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species)
  7. 2404093Species Escherichia coli [TaxId:562] [141382] (4 PDB entries)
    Uniprot P77398 201-304! Uniprot P77398 204-304
  8. 2404105Domain d4wkgc2: 4wkg C:201-304 [262101]
    Other proteins in same PDB: d4wkga1, d4wkga3, d4wkgb1, d4wkgb3, d4wkgc1, d4wkgc3, d4wkgd1, d4wkge1, d4wkgf1, d4wkgf3
    automated match to d1z7ea1
    complexed with act, dtt

Details for d4wkgc2

PDB Entry: 4wkg (more details), 2.7 Å

PDB Description: the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop- erativity
PDB Compounds: (C:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d4wkgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wkgc2 b.46.1.1 (C:201-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
rtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvi
svaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl

SCOPe Domain Coordinates for d4wkgc2:

Click to download the PDB-style file with coordinates for d4wkgc2.
(The format of our PDB-style files is described here.)

Timeline for d4wkgc2: