SCOPe 2.04: Domain d4wkge2: 4wkg E:201-304

Lineage for d4wkge2 (4wkg E:201-304)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)

6. Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species)

7. Species Escherichia coli [TaxId:562] [141382] (4 PDB entries)
   Uniprot P77398 201-304! Uniprot P77398 204-304

8. Domain d4wkge2: 4wkg E:201-304 [262100]
   Other proteins in same PDB: d4wkga1, d4wkga3, d4wkgb1, d4wkgb3, d4wkgc1, d4wkgc3, d4wkgd1, d4wkge1, d4wkgf1, d4wkgf3
   automated match to d1z7ea1

Details for d4wkge2

PDB Entry: 4wkg, 2.7 Å

PDB Description: the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop- erativity

PDB Compounds: (E:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d4wkge2:

Sequence; same for both SEQRES and ATOM records:

>d4wkge2 b.46.1.1 (E:201-304) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
rtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvi
svaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrl

Timeline for d4wkge2:

• d4wkge2 is new in SCOPe 2.04-stable
  
• d4wkge2 appears in SCOPe 2.05
  
• d4wkge2 appears in the current release, SCOPe 2.08