Lineage for d1ett.1 (1ett L:,H:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465597Protein Thrombin [50531] (2 species)
  7. 465598Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
  8. 465619Domain d1ett.1: 1ett L:,H: [26210]

Details for d1ett.1

PDB Entry: 1ett (more details), 2.5 Å

PDB Description: refined 2.3 angstroms x-ray crystal structure of bovine thrombin complexes formed with the benzamidine and arginine-based thrombin inhibitors napap, 4-tapap and mqpa: a starting point for improving antithrombotics

SCOP Domain Sequences for d1ett.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ett.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOP Domain Coordinates for d1ett.1:

Click to download the PDB-style file with coordinates for d1ett.1.
(The format of our PDB-style files is described here.)

Timeline for d1ett.1: