SCOPe 2.08: Domain d4whtp2: 4wht P:112-215

Lineage for d4whtp2 (4wht P:112-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries)

8. Domain d4whtp2: 4wht P:112-215 [262094]
   Other proteins in same PDB: d4whtb1, d4whtd1, d4whtf1, d4whth1, d4whtj1, d4whtl1, d4whtn1, d4whtp1, d4whtr1, d4whtt1, d4whtv1, d4whty1
   automated match to d1c5da2

Details for d4whtp2

PDB Entry: 4wht, 2.22 Å

PDB Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form

PDB Compounds: (P:) Light chain of the Fab fragment derived from neutralizing antibody 3/11

SCOPe Domain Sequences for d4whtp2:

Sequence; same for both SEQRES and ATOM records:

>d4whtp2 b.1.1.2 (P:112-215) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

Timeline for d4whtp2:

• d4whtp2 first appeared in SCOPe 2.04
  
• d4whtp2 appears in SCOPe 2.07