![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [262079] (6 PDB entries) |
![]() | Domain d4whtd2: 4wht D:112-216 [262084] Other proteins in same PDB: d4whtb1, d4whtd1, d4whtf1, d4whth1, d4whtj1, d4whtl1, d4whtn1, d4whtp1, d4whtr1, d4whtt1, d4whtv1, d4whty1 automated match to d1c5da2 |
PDB Entry: 4wht (more details), 2.22 Å
SCOPe Domain Sequences for d4whtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4whtd2 b.1.1.2 (D:112-216) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnrn
Timeline for d4whtd2: