| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries) |
| Domain d4whth1: 4wht H:0-111 [262073] Other proteins in same PDB: d4whtb2, d4whtd2, d4whtl2, d4whtn2, d4whtp2, d4whtr2, d4whtt2, d4whtv2, d4whty2 automated match to d1c5da1 |
PDB Entry: 4wht (more details), 2.22 Å
SCOPe Domain Sequences for d4whth1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4whth1 b.1.1.0 (H:0-111) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sdivltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnl
esgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelk
Timeline for d4whth1: