SCOPe 2.04: Domain d1bbr.1: 1bbr L:,H:,E:

Lineage for d1bbr.1 (1bbr L:,H:,E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
   Uniprot P00734 333-622

8. Domain d1bbr.1: 1bbr L:,H:,E: [26207]

Details for d1bbr.1

PDB Entry: 1bbr, 2.3 Å

PDB Description: the structure of residues 7-16 of the a alpha chain of human fibrinogen bound to bovine thrombin at 2.3 angstroms resolution

PDB Compounds: (E:) epsilon-thrombin, (H:) epsilon-thrombin, (L:) epsilon-thrombin

SCOPe Domain Sequences for d1bbr.1:

Sequence; same for both SEQRES and ATOM records:

>g1bbr.1 b.47.1.2 (L:,H:,E:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttXsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdace
gdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

Timeline for d1bbr.1:

• d1bbr.1 first appeared (with stable ids) in SCOP 1.55
  
• d1bbr.1 appears in SCOPe 2.03
  
• d1bbr.1 appears in SCOPe 2.05
  
• d1bbr.1 appears in the current release, SCOPe 2.08