Lineage for d4wfhf2 (4wfh F:107-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518492Domain d4wfhf2: 4wfh F:107-211 [262066]
    Other proteins in same PDB: d4wfhd1, d4wfhf1
    automated match to d3gnml2
    complexed with ca, d10, tl

Details for d4wfhf2

PDB Entry: 4wfh (more details), 3.01 Å

PDB Description: Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
PDB Compounds: (F:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d4wfhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wfhf2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4wfhf2:

Click to download the PDB-style file with coordinates for d4wfhf2.
(The format of our PDB-style files is described here.)

Timeline for d4wfhf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wfhf1