SCOPe 2.08: Domain d4wfhd2: 4wfh D:107-211

Lineage for d4wfhd2 (4wfh D:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4wfhd2: 4wfh D:107-211 [262065]
   Other proteins in same PDB: d4wfhd1, d4wfhe_, d4wfhf1, d4wfhg_
   automated match to d3gnml2
   complexed with ca, d10, tl

Details for d4wfhd2

PDB Entry: 4wfh, 3.01 Å

PDB Description: Human TRAAK K+ channel in a Tl+ bound nonconductive conformation

PDB Compounds: (D:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d4wfhd2:

Sequence; same for both SEQRES and ATOM records:

>d4wfhd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4wfhd2:

• d4wfhd2 first appeared in SCOPe 2.04
  
• d4wfhd2 appears in SCOPe 2.07