Lineage for d4wfhd1 (4wfh D:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761002Domain d4wfhd1: 4wfh D:1-106 [262060]
    Other proteins in same PDB: d4wfhd2, d4wfhe_, d4wfhf2, d4wfhg_
    automated match to d3gnml1
    complexed with ca, d10, tl

Details for d4wfhd1

PDB Entry: 4wfh (more details), 3.01 Å

PDB Description: Human TRAAK K+ channel in a Tl+ bound nonconductive conformation
PDB Compounds: (D:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d4wfhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wfhd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk

SCOPe Domain Coordinates for d4wfhd1:

Click to download the PDB-style file with coordinates for d4wfhd1.
(The format of our PDB-style files is described here.)

Timeline for d4wfhd1: