SCOPe 2.08: Domain d4wfed1: 4wfe D:1-106

Lineage for d4wfed1 (4wfe D:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4wfed1: 4wfe D:1-106 [262058]
   Other proteins in same PDB: d4wfed2, d4wfee_, d4wfef2, d4wfeg_
   automated match to d3gnml1
   complexed with ca, k

Details for d4wfed1

PDB Entry: 4wfe, 2.5 Å

PDB Description: Human TRAAK K+ channel in a K+ bound conductive conformation

PDB Compounds: (D:) anti-traak antibody 13e9 fab fragment light chain

SCOPe Domain Sequences for d4wfed1:

Sequence; same for both SEQRES and ATOM records:

>d4wfed1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk

Timeline for d4wfed1:

• d4wfed1 first appeared in SCOPe 2.04
  
• d4wfed1 appears in SCOPe 2.07