Lineage for d4w6yb1 (4w6y B:6-127)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 2347685Domain d4w6yb1: 4w6y B:6-127 [262056]
    Other proteins in same PDB: d4w6yb2, d4w6yb3
    automated match to d1zmya1
    complexed with so4

Details for d4w6yb1

PDB Entry: 4w6y (more details), 1.57 Å

PDB Description: co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf9
PDB Compounds: (B:) Nanobody NbFedF9

SCOPe Domain Sequences for d4w6yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w6yb1 b.1.1.1 (B:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgggsvqaggslrlscaasgytyssncmawfrqvpgkeregvasintrggityyadsvk
grftisrdnakntvslqmnslkpedtatyycaavreatysdnrcsvrsytydywgqgtqv
tv

SCOPe Domain Coordinates for d4w6yb1:

Click to download the PDB-style file with coordinates for d4w6yb1.
(The format of our PDB-style files is described here.)

Timeline for d4w6yb1: