SCOPe 2.07: Domain d1bth.1: 1bth L:,H:

Lineage for d1bth.1 (1bth L:,H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
   Uniprot P00734 333-622

8. Domain d1bth.1: 1bth L:,H: [26205]
   Other proteins in same PDB: d1bthp_, d1bthq_

Details for d1bth.1

PDB Entry: 1bth, 2.3 Å

PDB Description: structure of thrombin complexed with bovine pancreatic trypsin inhibitor

PDB Compounds: (H:) thrombin, (L:) thrombin

SCOPe Domain Sequences for d1bth.1:

Sequence; same for both SEQRES and ATOM records:

>g1bth.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
geadcglrplfekksledkterellesyidgXivegsdaeigmspwqvmlfrkspqellc
gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
ttnvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacqgdsggp
fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi

Timeline for d1bth.1:

• d1bth.1 first appeared (with stable ids) in SCOP 1.55
  
• d1bth.1 appears in SCOPe 2.06
  
• d1bth.1 appears in the current release, SCOPe 2.08