SCOP 1.55: Domain d1bth.1: 1bth L:,H:

Lineage for d1bth.1 (1bth L:,H:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (18 PDB entries)

8. Domain d1bth.1: 1bth L:,H: [26205]
   Other proteins in same PDB: d1bthp_, d1bthq_

Details for d1bth.1

PDB Entry: 1bth, 2.3 Å

PDB Description: structure of thrombin complexed with bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d1bth.1:

Sequence; same for both SEQRES and ATOM records:

>g1bth.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
geadcglrplfekksledkterellesyidgXivegsdaeigmspwqvmlfrkspqellc
gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
ttnvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacqgdsggp
fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvi

Timeline for d1bth.1:

• d1bth.1 appears in SCOP 1.57
  
• d1bth.1 appears in the current release, SCOPe 2.08