SCOPe 2.08: Domain d4v3db_: 4v3d B:

Lineage for d4v3db_ (4v3d B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Endothelial protein C receptor [75381] (1 species)
   phospholipid-binding protein

7. Species Human (Homo sapiens) [TaxId:9606] [75382] (4 PDB entries)

8. Domain d4v3db_: 4v3d B: [262047]
   automated match to d1lqvb_
   complexed with nag, pty

Details for d4v3db_

PDB Entry: 4v3d, 2.65 Å

PDB Description: the cidra domain from hb3var03 pfemp1 bound to endothelial protein c receptor

PDB Compounds: (B:) Endothelial protein C receptor

SCOPe Domain Sequences for d4v3db_:

Sequence; same for both SEQRES and ATOM records:

>d4v3db_ d.19.1.1 (B:) Endothelial protein C receptor {Human (Homo sapiens) [TaxId: 9606]}
qrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqsg
lqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfrp
eralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhi

Timeline for d4v3db_:

• d4v3db_ first appeared in SCOPe 2.04
  
• d4v3db_ appears in SCOPe 2.07