Class a: All alpha proteins [46456] (289 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.2: SAP domain [68906] (1 family) |
Family a.140.2.1: SAP domain [68907] (8 proteins) Pfam PF02037 |
Protein automated matches [254644] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255656] (2 PDB entries) |
Domain d4uzwa1: 4uzw A:2-50 [262042] Other proteins in same PDB: d4uzwa2 automated match to d2wqga_ |
PDB Entry: 4uzw (more details)
SCOPe Domain Sequences for d4uzwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uzwa1 a.140.2.1 (A:2-50) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} adyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskgesevspq
Timeline for d4uzwa1: