SCOPe 2.06: Domain d4uzwa1: 4uzw A:2-50

Lineage for d4uzwa1 (4uzw A:2-50)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.2: SAP domain [68906] (1 family)

5. Family a.140.2.1: SAP domain [68907] (8 proteins)
   Pfam PF02037

6. Protein automated matches [254644] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255656] (2 PDB entries)

8. Domain d4uzwa1: 4uzw A:2-50 [262042]
   Other proteins in same PDB: d4uzwa2
   automated match to d2wqga_

Details for d4uzwa1

PDB Entry: 4uzw

PDB Description: high-resolution nmr structures of the domains of saccharomyces cerevisiae tho1

PDB Compounds: (A:) protein tho1

SCOPe Domain Sequences for d4uzwa1:

Sequence; same for both SEQRES and ATOM records:

>d4uzwa1 a.140.2.1 (A:2-50) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
adyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskgesevspq

Timeline for d4uzwa1:

• d4uzwa1 first appeared in SCOPe 2.04, called d4uzwa_
  
• d4uzwa1 was called d4uzwa_ in SCOPe 2.05
  
• d4uzwa1 appears in SCOPe 2.07
  
• d4uzwa1 appears in the current release, SCOPe 2.08