Lineage for d4uzwa_ (4uzw A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506479Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 1506493Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 1506494Family a.140.2.1: SAP domain [68907] (8 proteins)
    Pfam PF02037
  6. 1506518Protein automated matches [254644] (1 species)
    not a true protein
  7. 1506519Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255656] (2 PDB entries)
  8. 1506520Domain d4uzwa_: 4uzw A: [262042]
    automated match to d2wqga_

Details for d4uzwa_

PDB Entry: 4uzw (more details)

PDB Description: high-resolution nmr structures of the domains of saccharomyces cerevisiae tho1
PDB Compounds: (A:) protein tho1

SCOPe Domain Sequences for d4uzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uzwa_ a.140.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sadyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskgesevspq

SCOPe Domain Coordinates for d4uzwa_:

Click to download the PDB-style file with coordinates for d4uzwa_.
(The format of our PDB-style files is described here.)

Timeline for d4uzwa_: