Lineage for d4uzwa1 (4uzw A:2-50)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734582Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 2734583Family a.140.2.1: SAP domain [68907] (8 proteins)
    Pfam PF02037
  6. 2734607Protein automated matches [254644] (1 species)
    not a true protein
  7. 2734608Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255656] (2 PDB entries)
  8. 2734609Domain d4uzwa1: 4uzw A:2-50 [262042]
    Other proteins in same PDB: d4uzwa2
    automated match to d2wqga_

Details for d4uzwa1

PDB Entry: 4uzw (more details)

PDB Description: high-resolution nmr structures of the domains of saccharomyces cerevisiae tho1
PDB Compounds: (A:) protein tho1

SCOPe Domain Sequences for d4uzwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uzwa1 a.140.2.1 (A:2-50) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
adyssltvvqlkdlltkrnlsvgglknelvqrlikddeeskgesevspq

SCOPe Domain Coordinates for d4uzwa1:

Click to download the PDB-style file with coordinates for d4uzwa1.
(The format of our PDB-style files is described here.)

Timeline for d4uzwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uzwa2