Lineage for d4ur8d_ (4ur8 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836020Species Agrobacterium tumefaciens [TaxId:358] [262022] (2 PDB entries)
  8. 2836028Domain d4ur8d_: 4ur8 D: [262040]
    Other proteins in same PDB: d4ur8a2
    automated match to d3pb2a_
    complexed with fmt, oog

Details for d4ur8d_

PDB Entry: 4ur8 (more details), 2.1 Å

PDB Description: Crystal structure of keto-deoxy-D-galactarate dehydratase complexed with 2-oxoadipic acid
PDB Compounds: (D:) keto-deoxy-d-galactarate dehydratase

SCOPe Domain Sequences for d4ur8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ur8d_ c.1.10.0 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl
kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe
glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfkdgtgdiglvrqita
kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri
lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk
rka

SCOPe Domain Coordinates for d4ur8d_:

Click to download the PDB-style file with coordinates for d4ur8d_.
(The format of our PDB-style files is described here.)

Timeline for d4ur8d_: