Lineage for d1ets.1 (1ets L:,H:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Thrombin [50531] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries) 
Domain d1ets.1: 1ets L:,H: [26202]
Details for d1ets.1
PDB Entry: 1ets (more details), 2.3 Å
PDB Description: refined 2.3 angstroms x-ray crystal structure of bovine thrombin complexes formed with the benzamidine and arginine-based thrombin inhibitors napap, 4-tapap and mqpa: a starting point for improving antithrombotics
SCOP Domain Sequences for d1ets.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ets.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
SCOP Domain Coordinates for d1ets.1:
Click to download the PDB-style file with coordinates for d1ets.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ets.1:
- d1ets.1 first appeared (with stable ids) in SCOP 1.55
- d1ets.1 appears in SCOP 1.59
- d1ets.1 appears in SCOP 1.63
- d1ets.1 appears in the current release, SCOPe 2.08
View in 3D