Lineage for d4ubwb1 (4ubw B:1-267)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917965Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)
  8. 2918036Domain d4ubwb1: 4ubw B:1-267 [262016]
    automated match to d1qfla1
    complexed with cl, dms, gol, na

Details for d4ubwb1

PDB Entry: 4ubw (more details), 2.7 Å

PDB Description: apo structure of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis
PDB Compounds: (B:) Acetyl-CoA acetyltransferase FadA5

SCOPe Domain Sequences for d4ubwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubwb1 c.95.1.0 (B:1-267) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
tqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgi
eamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrra
qrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggih
tagtssqisdgaaavlwmdeavarahg

SCOPe Domain Coordinates for d4ubwb1:

Click to download the PDB-style file with coordinates for d4ubwb1.
(The format of our PDB-style files is described here.)

Timeline for d4ubwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ubwb2