Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries) |
Domain d4ubva2: 4ubv A:268-391 [262015] Other proteins in same PDB: d4ubvb3 automated match to d2vu1a2 complexed with aco, coa, dio, gol, so4 |
PDB Entry: 4ubv (more details), 1.95 Å
SCOPe Domain Sequences for d4ubva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubva2 c.95.1.0 (A:268-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ltprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswar vhepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgti ieri
Timeline for d4ubva2: