SCOPe 2.08: Domain d4ubwa2: 4ubw A:268-391

Lineage for d4ubwa2 (4ubw A:268-391)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)

8. Domain d4ubwa2: 4ubw A:268-391 [262014]
   automated match to d2vu1a2
   complexed with cl, dms, gol, na

Details for d4ubwa2

PDB Entry: 4ubw, 2.7 Å

PDB Description: apo structure of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis

PDB Compounds: (A:) Acetyl-CoA acetyltransferase FadA5

SCOPe Domain Sequences for d4ubwa2:

Sequence; same for both SEQRES and ATOM records:

>d4ubwa2 c.95.1.0 (A:268-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswar
vhepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgti
ieri

Timeline for d4ubwa2:

• d4ubwa2 first appeared in SCOPe 2.04
  
• d4ubwa2 appears in SCOPe 2.07