![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries) |
![]() | Domain d4ubub2: 4ubu B:268-391 [262007] Other proteins in same PDB: d4ubue3, d4ubug3, d4ubuh3 automated match to d2vu1a2 complexed with coa, gol |
PDB Entry: 4ubu (more details), 3 Å
SCOPe Domain Sequences for d4ubub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubub2 c.95.1.0 (B:268-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ltprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswar vhepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgti ieri
Timeline for d4ubub2: