Lineage for d4u83a2 (4u83 A:227-375)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708504Species Brucella abortus [TaxId:1104320] [261999] (1 PDB entry)
  8. 2708505Domain d4u83a2: 4u83 A:227-375 [262005]
    Other proteins in same PDB: d4u83a1, d4u83a3, d4u83b1, d4u83b3, d4u83c1, d4u83c3, d4u83d1, d4u83d3
    automated match to d3nf4a2
    complexed with edo

Details for d4u83a2

PDB Entry: 4u83 (more details), 1.8 Å

PDB Description: structure of brucella abortus butyryl-coa dehydrogenase
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4u83a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u83a2 a.29.3.0 (A:227-375) automated matches {Brucella abortus [TaxId: 1104320]}
gegykialanleggrigiaaqavgmaraafeaardyareritfgkpiiehqavafrladm
atrietarqmvlhaaalreagkpclteasmaklvasemaeqvcsaaiqihggygyladyp
veriyrdvrvcqiyegtsdvqrlviargl

SCOPe Domain Coordinates for d4u83a2:

Click to download the PDB-style file with coordinates for d4u83a2.
(The format of our PDB-style files is described here.)

Timeline for d4u83a2: