| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Brucella abortus [TaxId:1104320] [261999] (1 PDB entry) |
| Domain d4u83c2: 4u83 C:227-375 [262004] Other proteins in same PDB: d4u83a1, d4u83a3, d4u83b1, d4u83b3, d4u83c1, d4u83c3, d4u83d1, d4u83d3 automated match to d3nf4a2 complexed with edo |
PDB Entry: 4u83 (more details), 1.8 Å
SCOPe Domain Sequences for d4u83c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u83c2 a.29.3.0 (C:227-375) automated matches {Brucella abortus [TaxId: 1104320]}
gegykialanleggrigiaaqavgmaraafeaardyareritfgkpiiehqavafrladm
atrietarqmvlhaaalreagkpclteasmaklvasemaeqvcsaaiqihggygyladyp
veriyrdvrvcqiyegtsdvqrlviargl
Timeline for d4u83c2: