SCOP 1.69: Domain d1ucy.2: 1ucy J:,K:

Lineage for d1ucy.2 (1ucy J:,K:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)

8. Domain d1ucy.2: 1ucy J:,K: [26200]

Details for d1ucy.2

PDB Entry: 1ucy, 2.2 Å

PDB Description: thrombin complexed with fibrinopeptide a alpha (residues 7-19). three complexes, one with epsilon-thrombin and two with alpha-thrombin

SCOP Domain Sequences for d1ucy.2:

Sequence; same for both SEQRES and ATOM records:

>g1ucy.2 b.47.1.2 (J:,K:) Thrombin {Cow (Bos taurus)}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

Timeline for d1ucy.2:

• d1ucy.2 first appeared (with stable ids) in SCOP 1.55
  
• d1ucy.2 appears in SCOP 1.67
  
• d1ucy.2 appears in SCOP 1.71
  
• d1ucy.2 appears in the current release, SCOPe 2.08