Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102923] (7 PDB entries) |
Domain d4u2ma2: 4u2m A:128-250 [261995] automated match to d1r2ba_ |
PDB Entry: 4u2m (more details), 2.23 Å
SCOPe Domain Sequences for d4u2ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u2ma2 d.42.1.1 (A:128-250) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} adsciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq lkcnlsvinldpeinpegfcilldfmytsrlnlregnimavmatamylqmehvvdtcrkf ika
Timeline for d4u2ma2: