SCOPe 2.06: Domain d4ty6a_: 4ty6 A:

Lineage for d4ty6a_ (4ty6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor XI [117237] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117238] (45 PDB entries)
   Uniprot P03951 388-624

8. Domain d4ty6a_: 4ty6 A: [261993]
   automated match to d1xxda_
   complexed with 39d, edo, so4

Details for d4ty6a_

PDB Entry: 4ty6, 1.85 Å

PDB Description: factor xia in complex with the inhibitor 4-{2-[(1s)-1-({[trans-4- (aminomethyl)cyclohexyl]carbonyl}amino)-2-phenylethyl]-1h-imidazol-4- yl}benzamide

PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d4ty6a_:

Sequence; same for both SEQRES and ATOM records:

>d4ty6a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

Timeline for d4ty6a_:

• d4ty6a_ first appeared in SCOPe 2.04
  
• d4ty6a_ appears in SCOPe 2.05
  
• d4ty6a_ appears in SCOPe 2.07
  
• d4ty6a_ appears in the current release, SCOPe 2.08