SCOPe 2.08: Domain d4tw7a1: 4tw7 A:16-140

Lineage for d4tw7a1 (4tw7 A:16-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)

8. Domain d4tw7a1: 4tw7 A:16-140 [261992]
   Other proteins in same PDB: d4tw7a2
   automated match to d3o5qa_
   complexed with 37k

Details for d4tw7a1

PDB Entry: 4tw7, 1.25 Å

PDB Description: The Fk1 domain of FKBP51 in complex with iFit4

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4tw7a1:

Sequence; same for both SEQRES and ATOM records:

>d4tw7a1 d.26.1.1 (A:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge

Timeline for d4tw7a1:

• d4tw7a1 first appeared in SCOPe 2.04, called d4tw7a_
  
• d4tw7a1 appears in SCOPe 2.07