SCOPe 2.06: Domain d4tr0b1: 4tr0 B:1-85

Lineage for d4tr0b1 (4tr0 B:1-85)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Alkaliphilus oremlandii [TaxId:350688] [260042] (2 PDB entries)

8. Domain d4tr0b1: 4tr0 B:1-85 [261991]
   Other proteins in same PDB: d4tr0a2, d4tr0b2
   automated match to d2khpa_
   complexed with act, gds

Details for d4tr0b1

PDB Entry: 4tr0, 1.95 Å

PDB Description: crystal structure of gssg-bound cgrx2

PDB Compounds: (B:) glutaredoxin 3

SCOPe Domain Sequences for d4tr0b1:

Sequence; same for both SEQRES and ATOM records:

>d4tr0b1 c.47.1.0 (B:1-85) automated matches {Alkaliphilus oremlandii [TaxId: 350688]}
mknitiytknycpyckkavsllsskgvdfkevdvthdskafedvmaktgwdtvpqvfvde
eflggcddihaldrqgildkklglk

Timeline for d4tr0b1:

• d4tr0b1 first appeared in SCOPe 2.04, called d4tr0b_
  
• d4tr0b1 was called d4tr0b_ in SCOPe 2.05
  
• d4tr0b1 appears in SCOPe 2.07
  
• d4tr0b1 appears in the current release, SCOPe 2.08