SCOPe 2.04: Domain d4tr1b_: 4tr1 B:

Lineage for d4tr1b_ (4tr1 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Alkaliphilus oremlandii [TaxId:350688] [260042] (2 PDB entries)

8. Domain d4tr1b_: 4tr1 B: [261989]
   automated match to d2khpa_
   complexed with gsh

Details for d4tr1b_

PDB Entry: 4tr1, 1.58 Å

PDB Description: crystal structure of gsh-bound cgrx2/c15s

PDB Compounds: (B:) glutaredoxin 3

SCOPe Domain Sequences for d4tr1b_:

Sequence; same for both SEQRES and ATOM records:

>d4tr1b_ c.47.1.0 (B:) automated matches {Alkaliphilus oremlandii [TaxId: 350688]}
mknitiytknycpyskkavsllsskgvdfkevdvthdskafedvmaktgwdtvpqvfvde
eflggcddihaldrqgildkklglklehhhhh

Timeline for d4tr1b_:

• d4tr1b_ is new in SCOPe 2.04-stable
  
• d4tr1b_ appears in SCOPe 2.05
  
• d4tr1b_ appears in the current release, SCOPe 2.08, called d4tr1b1