SCOP 1.57: Domain d1etr.1: 1etr L:,H:

Lineage for d1etr.1 (1etr L:,H:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)

8. Domain d1etr.1: 1etr L:,H: [26198]

Details for d1etr.1

PDB Entry: 1etr, 2.2 Å

PDB Description: refined 2.3 angstroms x-ray crystal structure of bovine thrombin complexes formed with the benzamidine and arginine-based thrombin inhibitors napap, 4-tapap and mqpa: a starting point for improving antithrombotics

SCOP Domain Sequences for d1etr.1:

Sequence; same for both SEQRES and ATOM records:

>g1etr.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

Timeline for d1etr.1:

• d1etr.1 first appeared (with stable ids) in SCOP 1.55
  
• d1etr.1 appears in SCOP 1.59
  
• d1etr.1 appears in the current release, SCOPe 2.08