Lineage for d2ruda_ (2rud A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1899921Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1900058Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 1900059Species Human (Homo sapiens) [TaxId:9606] [54548] (46 PDB entries)
  8. 1900105Domain d2ruda_: 2rud A: [261978]
    automated match to d1nmwa_
    mutant

Details for d2ruda_

PDB Entry: 2rud (more details)

PDB Description: Solution structure of the peptidyl prolyl cis-trans isomerase domain of C113D mutant human Pin1 with sulfate ion
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2ruda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ruda_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
gshmeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfesl
asqfsddssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d2ruda_:

Click to download the PDB-style file with coordinates for d2ruda_.
(The format of our PDB-style files is described here.)

Timeline for d2ruda_: