SCOPe 2.05: Domain d4rv4c_: 4rv4 C:

Lineage for d4rv4c_ (4rv4 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [259286] (2 PDB entries)

8. Domain d4rv4c_: 4rv4 C: [261977]
   automated match to d3oscb_
   complexed with peg, prp

Details for d4rv4c_

PDB Entry: 4rv4, 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp)

PDB Compounds: (C:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d4rv4c_:

Sequence, based on SEQRES records:

>d4rv4c_ c.61.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
qsnamkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaaglee
likehfptveviagtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaekgqkv
vvvedlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysa
ltevaaekgiigqaetkklqewrknpadeawita

Sequence, based on observed residues (ATOM records):

>d4rv4c_ c.61.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
qsnamkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaaglee
likehfptveviagtatagiahaawvsdrmdlpmcyviegkaekgqkvvvvedlistggs
aitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysaltevaaekgiig
qaetkklqewrknpadeawita

Timeline for d4rv4c_:

• d4rv4c_ first appeared in SCOPe 2.04
  
• d4rv4c_ is called d4rv4c1 in SCOPe 2.06
  
• d4rv4c_ appears in the current release, SCOPe 2.08, called d4rv4c1