Lineage for d4rv4c1 (4rv4 C:1-210)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2128698Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [259286] (2 PDB entries)
  8. 2128705Domain d4rv4c1: 4rv4 C:1-210 [261977]
    Other proteins in same PDB: d4rv4a2, d4rv4b2, d4rv4c2
    automated match to d3oscb_
    complexed with peg, prp

Details for d4rv4c1

PDB Entry: 4rv4 (more details), 2.65 Å

PDB Description: 2.65 angstrom resolution crystal structure of an orotate phosphoribosyltransferase from bacillus anthracis str. 'ames ancestor' in complex with 5-phospho-alpha-d-ribosyl diphosphate (prpp)
PDB Compounds: (C:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d4rv4c1:

Sequence, based on SEQRES records: (download)

>d4rv4c1 c.61.1.0 (C:1-210) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelike
hfptveviagtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaekgqkvvvve
dlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysaltev
aaekgiigqaetkklqewrknpadeawita

Sequence, based on observed residues (ATOM records): (download)

>d4rv4c1 c.61.1.0 (C:1-210) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaagleelike
hfptveviagtatagiahaawvsdrmdlpmcyviegkaekgqkvvvvedlistggsaitc
vealreagcevlgivsiftyeleagkekleaanvasyslsdysaltevaaekgiigqaet
kklqewrknpadeawita

SCOPe Domain Coordinates for d4rv4c1:

Click to download the PDB-style file with coordinates for d4rv4c1.
(The format of our PDB-style files is described here.)

Timeline for d4rv4c1: